HORDB

ID: hor002019
Uniprot ID: P37042
Protein name: GnRH-associated peptide 1
Gene name: GNRH1
Organism: Gallus gallus (Chicken)
Family: GnRH family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Gallus (genus), Phasianinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity; GO:0005515 protein binding; GO:0031530 gonadotropin-releasing hormone receptor binding
GO BP: GO:0000003 reproduction; GO:0007165 signal transduction; GO:0032275 luteinizing hormone secretion; GO:0033686 positive regulation of luteinizing hormone secretion; GO:0043279 response to alkaloid; GO:0046885 regulation of hormone biosynthetic process; GO:1904014 response to serotonin; GO:2000843 regulation of testosterone secretion
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: NAENLVESFQEIANEMESLGEGQKAECPGSYQHPRLSDLKETMASLIEGEARRKEI
Length: 56
Propeptide: MEKSRKILVGVLLFTASVAICLAQHWSYGLQPGGKRNAENLVESFQEIANEMESLGEGQKAECPGSYQHPRLSDLKETMASLIEGEARRKEI
Signal peptide: MEKSRKILVGVLLFTASVAICLA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002019_AF2.pdb

hor002019_ESM.pdb

Mass:	724612	Formula:	C264H426N76O94S3
Absent amino acids:	W	Common amino acids:	E
pI:	4.26	Basic residues:	7
Polar residues:	15	Hydrophobic residues:	15
Hydrophobicity:	-84.64	Boman Index:	-14078
Half-Life:	1.4 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	69.82
Instability Index:	5251.25	Extinction Coefficient cystines:	1490
Absorbance 280nm:	27.09